ANTI-HNRNPU (C-TERMINAL) ANTIBODY PRODUC

Code: SAB2109025-100UL D2-231

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to b...


 Read more

Your Price
€398.00 100UL
€489.54 inc. VAT

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

General description

HNRNPU belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. HNRNPU contains a RNA binding domain and scaffold-associated region (SAR)-specific bipartite DNA-binding domain. This protein is also thought to be involved in the packaging of hnRNA into large ribonucleoprotein complexes. During apoptosis, this protein is cleaved in a caspase-dependent way. But this cleavage does not affect the function of the encoded protein in RNA metabolism.

Immunogen

Synthetic peptide directed towards the C terminal region of human HNRNPU

Physical form

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

Sequence

Synthetic peptide located within the following region: EITYVELQKEEAQKLLEQYKEESKKALPPEKKQNTGSKKSNKNKSGKNQF

antibody formaffinity isolated antibody
antibody product typeprimary antibodies
biological sourcerabbit
clonepolyclonal
concentration0.5 mg/mL
conjugateunconjugated
formbuffered aqueous solution
Gene Informationhuman ... HNRNPU(57396)
mol wt90 kDa
NCBI accession no.NM_031844
shipped inwet ice
species reactivity (predicted by homology)rat, bovine, rabbit, guinea pig, human, horse, mouse, canine
storage temp.−20°C
technique(s)western blot: 1 µg/mL
This product has met the following criteria to qualify for the following awards:



HAVE AN ACCOUNT? LOGIN

GUEST CHECKOUT

Proceed as a guest. You will have the option to register to access exclusive pricing and stock availability features after checkout.